RNF39 antibody (70R-1169)

Rabbit polyclonal RNF39 antibody raised against the C terminal of RNF39

Synonyms Polyclonal RNF39 antibody, Anti-RNF39 antibody, HZFW antibody, HZF antibody, RNF-39 antibody, RNF-39, RNF39, RNF 39, LIRF antibody, Ring Finger Protein 39 antibody, RNF 39 antibody
Specificity RNF39 antibody was raised against the C terminal of RNF39
Cross Reactivity Human
Applications WB
Immunogen RNF39 antibody was raised using the C terminal of RNF39 corresponding to a region with amino acids CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL
Assay Information RNF39 Blocking Peptide, catalog no. 33R-1798, is also available for use as a blocking control in assays to test for specificity of this RNF39 antibody

Images

Western Blot analysis using RNF39 antibody (70R-1169)

RNF39 antibody (70R-1169) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RNF39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Its gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that RNF39 plays a role in an early phase of synaptic plasticity. Its gene lies within the major histocompatibility complex class I region on chromosome 6.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF39 antibody (70R-1169) | RNF39 antibody (70R-1169) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors