RBM4B Blocking Peptide (33R-1001)
A synthetic peptide for use as a blocking control in assays to test for specificity of RNF5 antibody, catalog no. 70R-9592
Overview
Overview
| Synonyms | RNF5 control peptide, RNF5 antibody Blocking Peptide, Anti-RNF5 Blocking Peptide, ring finger protein 5 Blocking Peptide, RING5 Blocking Peptide, RMA1 Blocking Peptide, RNF5, RNF-5, RNF 5, RNF-5 Blocking Peptide, RNF 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL |
|---|---|
| Molecular Weight | 20 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RNF5 contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product