RBM4B Blocking Peptide (33R-1001)

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF5 antibody, catalog no. 70R-9592

Synonyms RNF5 control peptide, RNF5 antibody Blocking Peptide, Anti-RNF5 Blocking Peptide, ring finger protein 5 Blocking Peptide, RING5 Blocking Peptide, RMA1 Blocking Peptide, RNF5, RNF-5, RNF 5, RNF-5 Blocking Peptide, RNF 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL
Molecular Weight 20 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF5 contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors