RNPEPL1 antibody (70R-4371)

Rabbit polyclonal RNPEPL1 antibody

Synonyms Polyclonal RNPEPL1 antibody, Anti-RNPEPL1 antibody, RNPEPL-1, Aminopeptidase B-Like 1 antibody, RNPEPL-1 antibody, FLJ10806 antibody, Arginyl Aminopeptidase antibody, MGC99544 antibody, RNPEPL1, RNPEPL 1, FLJ26675 antibody, RNPEPL 1 antibody
Cross Reactivity Human
Applications WB
Immunogen RNPEPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD
Assay Information RNPEPL1 Blocking Peptide, catalog no. 33R-5096, is also available for use as a blocking control in assays to test for specificity of this RNPEPL1 antibody


Western Blot analysis using RNPEPL1 antibody (70R-4371)

RNPEPL1 antibody (70R-4371) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNPEPL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNPEPL1 is thought to posess aminopeptidase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNPEPL1 antibody (70R-4371) | RNPEPL1 antibody (70R-4371) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors