RORA Blocking Peptide (33R-9233)

A synthetic peptide for use as a blocking control in assays to test for specificity of RORA antibody, catalog no. 70R-1921

Synonyms RORA control peptide, RORA antibody Blocking Peptide, Anti-RORA Blocking Peptide, Rar-Related Orphan Receptor A Blocking Peptide, MGC119326 Blocking Peptide, MGC119329 Blocking Peptide, NR1F1 Blocking Peptide, ROR1 Blocking Peptide, ROR2 Blocking Peptide, ROR3 Blocking Peptide, RZRA Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS
Molecular Weight 63 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors