RP11-298P3.3 Blocking Peptide (33R-9278)
A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-298P3.3 antibody, catalog no. 70R-9321
Overview
Overview
| Synonyms | RP11-298P3.3 control peptide, RP11-298P3.3 antibody Blocking Peptide, Anti-RP11-298P3.3 Blocking Peptide, NEDD4 binding protein 2-like 2 Blocking Peptide, 92M18.3 Blocking Peptide, CG005 Blocking Peptide, FLJ36195 Blocking Peptide, FLJ41089 Blocking Peptide, FLJ43077 Blocking Peptide, PFAAP5 Blocking Peptide, RP11-298P3.3, RP-298P3.3-11, RP-298P3.3 11, RP-298P3.3-11 Blocking Peptide, RP-298P3.3 11 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TSCSLGVTSDFHFLNERFDRKLKRWEEPKELPAEDSQDLTSTDYRSLELP |
|---|---|
| Molecular Weight | 87 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of this protein remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product