RP11-298P3.3 Blocking Peptide (33R-9278)

A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-298P3.3 antibody, catalog no. 70R-9321

Synonyms RP11-298P3.3 control peptide, RP11-298P3.3 antibody Blocking Peptide, Anti-RP11-298P3.3 Blocking Peptide, NEDD4 binding protein 2-like 2 Blocking Peptide, 92M18.3 Blocking Peptide, CG005 Blocking Peptide, FLJ36195 Blocking Peptide, FLJ41089 Blocking Peptide, FLJ43077 Blocking Peptide, PFAAP5 Blocking Peptide, RP11-298P3.3, RP-298P3.3-11, RP-298P3.3 11, RP-298P3.3-11 Blocking Peptide, RP-298P3.3 11 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TSCSLGVTSDFHFLNERFDRKLKRWEEPKELPAEDSQDLTSTDYRSLELP
Molecular Weight 87 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors