RP2 antibody (70R-4335)

Rabbit polyclonal RP2 antibody

Synonyms Polyclonal RP2 antibody, Anti-RP2 antibody, Retinitis Pigmentosa 2 antibody, RP-2, RP-2 antibody, RP 2, KIAA0215 antibody, RP 2 antibody, TBCCD2 antibody, RP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG
Assay Information RP2 Blocking Peptide, catalog no. 33R-4895, is also available for use as a blocking control in assays to test for specificity of this RP2 antibody

Images

Western Blot analysis using RP2 antibody (70R-4335)

RP2 antibody (70R-4335) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RP2 antibody (70R-4335) | RP2 antibody (70R-4335) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors