RPA4 antibody (70R-5578)

Rabbit polyclonal RPA4 antibody raised against the C terminal of RPA4

Synonyms Polyclonal RPA4 antibody, Anti-RPA4 antibody, HSU24186 antibody, RPA 4 antibody, Replication Protein A4 34Kda antibody, RPA-4, RPA-4 antibody, RPA4, MGC120334 antibody, RPA 4, MGC120333 antibody
Specificity RPA4 antibody was raised against the C terminal of RPA4
Cross Reactivity Human
Applications WB
Immunogen RPA4 antibody was raised using the C terminal of RPA4 corresponding to a region with amino acids HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD
Assay Information RPA4 Blocking Peptide, catalog no. 33R-3818, is also available for use as a blocking control in assays to test for specificity of this RPA4 antibody


Western Blot analysis using RPA4 antibody (70R-5578)

RPA4 antibody (70R-5578) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32 kDa subunit of the RPA, which associates with the 70- and 13 kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPA4 antibody (70R-5578) | RPA4 antibody (70R-5578) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors