RPESP antibody (70R-3574)

Rabbit polyclonal RPESP antibody raised against the middle region of RPESP

Synonyms Polyclonal RPESP antibody, Anti-RPESP antibody, Rpe-Spondin antibody, FLJ40021 antibody
Specificity RPESP antibody was raised against the middle region of RPESP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
Assay Information RPESP Blocking Peptide, catalog no. 33R-5349, is also available for use as a blocking control in assays to test for specificity of this RPESP antibody


Western Blot analysis using RPESP antibody (70R-3574)

RPESP antibody (70R-3574) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPESP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPESP antibody (70R-3574) | RPESP antibody (70R-3574) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors