RPIA Blocking Peptide (33R-6341)

A synthetic peptide for use as a blocking control in assays to test for specificity of RPIA antibody, catalog no. 70R-4423

Synonyms RPIA control peptide, RPIA antibody Blocking Peptide, Anti-RPIA Blocking Peptide, Ribose 5-Phosphate Isomerase A Blocking Peptide, Ribose 5-Phosphate Epimerase Blocking Peptide, RPI Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors