RPIA Blocking Peptide (33R-6341)
A synthetic peptide for use as a blocking control in assays to test for specificity of RPIA antibody, catalog no. 70R-4423
Overview
Overview
| Synonyms | RPIA control peptide, RPIA antibody Blocking Peptide, Anti-RPIA Blocking Peptide, Ribose 5-Phosphate Isomerase A Blocking Peptide, Ribose 5-Phosphate Epimerase Blocking Peptide, RPI Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product