RPL10A antibody (70R-3210)

Rabbit polyclonal RPL10A antibody raised against the middle region of RPL10A

Synonyms Polyclonal RPL10A antibody, Anti-RPL10A antibody, Csa-19 antibody, RPL10, NEDD6 antibody, RPL-10, RPL 10 antibody, Ribosomal Protein L10A antibody, RPL 10, RPL-10 antibody
Specificity RPL10A antibody was raised against the middle region of RPL10A
Cross Reactivity Human
Applications WB
Immunogen RPL10A antibody was raised using the middle region of RPL10A corresponding to a region with amino acids YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK
Assay Information RPL10A Blocking Peptide, catalog no. 33R-10063, is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody

Images

Western Blot analysis using RPL10A antibody (70R-3210)

RPL10A antibody (70R-3210) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPL10A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPL10A antibody (70R-3210) | RPL10A antibody (70R-3210) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors