RPL13 antibody (70R-1470)

Rabbit polyclonal RPL13 antibody raised against the C terminal of RPL13

Synonyms Polyclonal RPL13 antibody, Anti-RPL13 antibody, RPL-13 antibody, Ribosomal Protein L13 antibody, RPL-13, MGC71373 antibody, RPL 13 antibody, RPL 13, BBC1 antibody, RPL13, D16S444E antibody
Specificity RPL13 antibody was raised against the C terminal of RPL13
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen RPL13 antibody was raised using the C terminal of RPL13 corresponding to a region with amino acids KGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMA
Assay Information RPL13 Blocking Peptide, catalog no. 33R-4385, is also available for use as a blocking control in assays to test for specificity of this RPL13 antibody

Images

Western Blot analysis using RPL13 antibody (70R-1470)

RPL13 antibody (70R-1470) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RPL13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL13 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPL13 antibody (70R-1470) | RPL13 antibody (70R-1470) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors