DFNA5 Blocking Peptide (33R-1034)

A synthetic peptide for use as a blocking control in assays to test for specificity of RPL32 antibody, catalog no. 70R-1471

Synonyms RPL32 control peptide, RPL32 antibody Blocking Peptide, Anti-RPL32 Blocking Peptide, Ribosomal Protein L32 Blocking Peptide, RPL32, RPL-32, RPL 32, RPL-32 Blocking Peptide, RPL 32 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG
Molecular Weight 15 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors