DFNA5 Blocking Peptide (33R-1034)
A synthetic peptide for use as a blocking control in assays to test for specificity of RPL32 antibody, catalog no. 70R-1471
Overview
Overview
| Synonyms | RPL32 control peptide, RPL32 antibody Blocking Peptide, Anti-RPL32 Blocking Peptide, Ribosomal Protein L32 Blocking Peptide, RPL32, RPL-32, RPL 32, RPL-32 Blocking Peptide, RPL 32 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG |
|---|---|
| Molecular Weight | 15 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product