RPL8 antibody (70R-1426)

Rabbit polyclonal RPL8 antibody raised against the C terminal of RPL8

Synonyms Polyclonal RPL8 antibody, Anti-RPL8 antibody, RPL-8 antibody, RPL 8 antibody, RPL-8, RPL8, Ribosomal Protein L8 antibody, RPL 8
Specificity RPL8 antibody was raised against the C terminal of RPL8
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN
Assay Information RPL8 Blocking Peptide, catalog no. 33R-2455, is also available for use as a blocking control in assays to test for specificity of this RPL8 antibody


Immunohistochemical staining using RPL8 antibody (70R-1426)

RPL8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RPL8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.3125 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL8 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using RPL8 antibody (70R-1426) | RPL8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using RPL8 antibody (70R-1426) | RPL8 antibody (70R-1426) used at 0.3125 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors