RPS14 antibody (70R-1393)

Rabbit polyclonal RPS14 antibody raised against the N terminal of RPS14

Synonyms Polyclonal RPS14 antibody, Anti-RPS14 antibody, RPS 14, RPS14, RPS 14 antibody, RPS-14, Ribosomal Protein S14 antibody, RPS-14 antibody
Specificity RPS14 antibody was raised against the N terminal of RPS14
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications WB
Immunogen RPS14 antibody was raised using the N terminal of RPS14 corresponding to a region with amino acids APRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKE
Assay Information RPS14 Blocking Peptide, catalog no. 33R-1437, is also available for use as a blocking control in assays to test for specificity of this RPS14 antibody


Western Blot analysis using RPS14 antibody (70R-1393)

RPS14 antibody (70R-1393) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RPS14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPS14 antibody (70R-1393) | RPS14 antibody (70R-1393) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors