RPS6KA2 antibody (70R-5759)

Rabbit polyclonal RPS6KA2 antibody raised against the middle region of RPS6KA2

Synonyms Polyclonal RPS6KA2 antibody, Anti-RPS6KA2 antibody, HU-2 antibody, RPS6KA2, RPSKA2-6, RPSKA2 6, pp90RSK3 antibody, Ribosomal Protein S6 Kinase 90Kda Polypeptide 2 antibody, RPSKA2 6 antibody, S6K-alpha2 antibody, p90-RSK3 antibody, S6K-alpha antibody, RSK3 antibody, MAPKAPK1C antibody, RPSKA2-6 antibody, RSK antibody
Specificity RPS6KA2 antibody was raised against the middle region of RPS6KA2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPS6KA2 antibody was raised using the middle region of RPS6KA2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR
Assay Information RPS6KA2 Blocking Peptide, catalog no. 33R-5450, is also available for use as a blocking control in assays to test for specificity of this RPS6KA2 antibody

Images

Western Blot analysis using RPS6KA2 antibody (70R-5759)

RPS6KA2 antibody (70R-5759) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPS6KA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPS6KA2 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPS6KA2 antibody (70R-5759) | RPS6KA2 antibody (70R-5759) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors