RPS7 antibody (70R-4990)

Rabbit polyclonal RPS7 antibody raised against the middle region of RPS7

Synonyms Polyclonal RPS7 antibody, Anti-RPS7 antibody, RPS 7 antibody, RPS 7, RPS7, RPS-7 antibody, Ribosomal Protein S7 antibody, RPS-7
Specificity RPS7 antibody was raised against the middle region of RPS7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPS7 antibody was raised using the middle region of RPS7 corresponding to a region with amino acids RIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEF
Assay Information RPS7 Blocking Peptide, catalog no. 33R-7979, is also available for use as a blocking control in assays to test for specificity of this RPS7 antibody

Images

Western Blot analysis using RPS7 antibody (70R-4990)

RPS7 antibody (70R-4990) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPS7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPS7 antibody (70R-4990) | RPS7 antibody (70R-4990) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors