RPUSD2 antibody (70R-4977)

Rabbit polyclonal RPUSD2 antibody raised against the C terminal of RPUSD2

Synonyms Polyclonal RPUSD2 antibody, Anti-RPUSD2 antibody, RPUSD 2, C18B11 antibody, RNA Pseudouridylate Synthase Domain Containing 2 antibody, RPUSD-2 antibody, RPUSD-2, RPUSD2, FLJ31409 antibody, RPUSD 2 antibody, C15orf19 antibody
Specificity RPUSD2 antibody was raised against the C terminal of RPUSD2
Cross Reactivity Human
Applications WB
Immunogen RPUSD2 antibody was raised using the C terminal of RPUSD2 corresponding to a region with amino acids AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE
Assay Information RPUSD2 Blocking Peptide, catalog no. 33R-1132, is also available for use as a blocking control in assays to test for specificity of this RPUSD2 antibody


Western Blot analysis using RPUSD2 antibody (70R-4977)

RPUSD2 antibody (70R-4977) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPUSD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPUSD2 is involved in RNA binding and nucleotide binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPUSD2 antibody (70R-4977) | RPUSD2 antibody (70R-4977) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors