RPUSD3 antibody (70R-4981)

Rabbit polyclonal RPUSD3 antibody raised against the middle region of RPUSD3

Synonyms Polyclonal RPUSD3 antibody, Anti-RPUSD3 antibody, RPUSD 3 antibody, RPUSD 3, RPUSD-3, RNA Pseudouridylate Synthase Domain Containing 3 antibody, RPUSD-3 antibody, FLJ34707 antibody, RPUSD3, MGC29784 antibody
Specificity RPUSD3 antibody was raised against the middle region of RPUSD3
Cross Reactivity Human
Applications WB
Immunogen RPUSD3 antibody was raised using the middle region of RPUSD3 corresponding to a region with amino acids MVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHL
Assay Information RPUSD3 Blocking Peptide, catalog no. 33R-6594, is also available for use as a blocking control in assays to test for specificity of this RPUSD3 antibody

Images

Western Blot analysis using RPUSD3 antibody (70R-4981)

RPUSD3 antibody (70R-4981) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPUSD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of RPUSD3 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPUSD3 antibody (70R-4981) | RPUSD3 antibody (70R-4981) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors