RRAD antibody (70R-5798)

Rabbit polyclonal RRAD antibody raised against the middle region of RRAD

Synonyms Polyclonal RRAD antibody, Anti-RRAD antibody, RAD antibody, RAD1 antibody, REM3 antibody, Ras-Related Associated With Diabetes antibody
Specificity RRAD antibody was raised against the middle region of RRAD
Cross Reactivity Human
Applications WB
Immunogen RRAD antibody was raised using the middle region of RRAD corresponding to a region with amino acids YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ
Assay Information RRAD Blocking Peptide, catalog no. 33R-10070, is also available for use as a blocking control in assays to test for specificity of this RRAD antibody


Western Blot analysis using RRAD antibody (70R-5798)

RRAD antibody (70R-5798) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RRAD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RRAD antibody (70R-5798) | RRAD antibody (70R-5798) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors