RRAD Blocking Peptide (33R-10070)
A synthetic peptide for use as a blocking control in assays to test for specificity of RRAD antibody, catalog no. 70R-5798
Overview
Overview
| Synonyms | RRAD control peptide, RRAD antibody Blocking Peptide, Anti-RRAD Blocking Peptide, Ras-Related Associated With Diabetes Blocking Peptide, RAD Blocking Peptide, RAD1 Blocking Peptide, REM3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product