RRAD Blocking Peptide (33R-10070)

A synthetic peptide for use as a blocking control in assays to test for specificity of RRAD antibody, catalog no. 70R-5798

Synonyms RRAD control peptide, RRAD antibody Blocking Peptide, Anti-RRAD Blocking Peptide, Ras-Related Associated With Diabetes Blocking Peptide, RAD Blocking Peptide, RAD1 Blocking Peptide, REM3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues YDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQ
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors