RRP1B antibody (70R-1969)

Rabbit polyclonal RRP1B antibody

Synonyms Polyclonal RRP1B antibody, Anti-RRP1B antibody, Nnp1 antibody, Ribosomal Rna Processing 1 Homolog B antibody, KIAA0179 antibody, RRP 1, RRP1, RRP1 antibody, RRP-1 antibody, RRP-1, RRP 1 antibody
Cross Reactivity Human
Applications WB
Immunogen RRP1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP
Assay Information RRP1B Blocking Peptide, catalog no. 33R-9842, is also available for use as a blocking control in assays to test for specificity of this RRP1B antibody


Western Blot analysis using RRP1B antibody (70R-1969)

RRP1B antibody (70R-1969) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RRP1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RRP1B belongs to the RRP1 family. It may be a novel susceptibility gene for breast cancer progression and metastasis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RRP1B antibody (70R-1969) | RRP1B antibody (70R-1969) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors