RRP9 antibody (70R-1341)

Rabbit polyclonal RRP9 antibody raised against the middle region of RRP9

Synonyms Polyclonal RRP9 antibody, Anti-RRP9 antibody, RRP-9, RRP-9 antibody, Ssu Processome Component Homolog antibody, RRP 9 antibody, RRP 9, RRP9, Rrp9 Small Subunit antibody
Specificity RRP9 antibody was raised against the middle region of RRP9
Cross Reactivity Human
Applications WB
Immunogen RRP9 antibody was raised using the middle region of RRP9 corresponding to a region with amino acids IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH
Assay Information RRP9 Blocking Peptide, catalog no. 33R-4097, is also available for use as a blocking control in assays to test for specificity of this RRP9 antibody


Western Blot analysis using RRP9 antibody (70R-1341)

RRP9 antibody (70R-1341) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RRP9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RRP9 contains 7 WD repeats and belongs to the WD repeat RRP9 family. It is a component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RRP9 antibody (70R-1341) | RRP9 antibody (70R-1341) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors