RSAD2 antibody (70R-1595)

Rabbit polyclonal RSAD2 antibody raised against the N terminal of RSAD2

Synonyms Polyclonal RSAD2 antibody, Anti-RSAD2 antibody, Radical S-Adenosyl Methionine Domain Containing 2 antibody, 2510004L01Rik antibody, RSAD-2, RSAD-2 antibody, cig33 antibody, RSAD2, cig5 antibody, RSAD 2 antibody, RSAD 2, vig1 antibody
Specificity RSAD2 antibody was raised against the N terminal of RSAD2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RSAD2 antibody was raised using the N terminal of RSAD2 corresponding to a region with amino acids PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP
Assay Information RSAD2 Blocking Peptide, catalog no. 33R-7188, is also available for use as a blocking control in assays to test for specificity of this RSAD2 antibody


Western Blot analysis using RSAD2 antibody (70R-1595)

RSAD2 antibody (70R-1595) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RSAD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RSAD2 is a potential antiviral effector.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RSAD2 antibody (70R-1595) | RSAD2 antibody (70R-1595) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors