RSRC2 antibody (70R-1069)

Rabbit polyclonal RSRC2 antibody raised against the C terminal of RSRC2

Synonyms Polyclonal RSRC2 antibody, Anti-RSRC2 antibody, RSRC 2 antibody, FLJ11021 antibody, Arginine/Serine-Rich Coiled-Coil 2 antibody, RSRC2, RSRC-2, RSRC-2 antibody, RSRC 2
Specificity RSRC2 antibody was raised against the C terminal of RSRC2
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS
Assay Information RSRC2 Blocking Peptide, catalog no. 33R-2134, is also available for use as a blocking control in assays to test for specificity of this RSRC2 antibody


Western Blot analysis using RSRC2 antibody (70R-1069)

RSRC2 antibody (70R-1069) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RSRC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance In vitro study revealed that RSRC2 might play a role in cell proliferation. RSRC2 may be a novel tumor suppressor of esophageal cancer cell growth.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RSRC2 antibody (70R-1069) | RSRC2 antibody (70R-1069) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using RSRC2 antibody (70R-1069) | RSRC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors