RTN4 Blocking Peptide (33R-7833)

A synthetic peptide for use as a blocking control in assays to test for specificity of RTN4 antibody, catalog no. 70R-7137

Synonyms RTN4 control peptide, RTN4 antibody Blocking Peptide, Anti-RTN4 Blocking Peptide, Reticulon 4 Blocking Peptide, ASY Blocking Peptide, NI220/250 Blocking Peptide, NOGO Blocking Peptide, NOGO-A Blocking Peptide, NOGOC Blocking Peptide, NSP Blocking Peptide, NSP-CL Blocking Peptide, Nbla00271 Blocking Peptide, Nbla10545 Blocking Peptide, Nogo-B Blocking Peptide, Nogo-C Blocking Peptide, RTN-X Blocking Peptide, RTN4-A Blocking Peptide, RTN4-B1 Blocking Peptide, RTN4-B2 Blocking Peptide, RTN4-C Blocking Peptide, RTN4, RTN-4, RTN 4, RTN-4 Blocking Peptide, RTN 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
Molecular Weight 22 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors