RTN4 Blocking Peptide (33R-7833)
A synthetic peptide for use as a blocking control in assays to test for specificity of RTN4 antibody, catalog no. 70R-7137
Overview
Overview
| Synonyms | RTN4 control peptide, RTN4 antibody Blocking Peptide, Anti-RTN4 Blocking Peptide, Reticulon 4 Blocking Peptide, ASY Blocking Peptide, NI220/250 Blocking Peptide, NOGO Blocking Peptide, NOGO-A Blocking Peptide, NOGOC Blocking Peptide, NSP Blocking Peptide, NSP-CL Blocking Peptide, Nbla00271 Blocking Peptide, Nbla10545 Blocking Peptide, Nogo-B Blocking Peptide, Nogo-C Blocking Peptide, RTN-X Blocking Peptide, RTN4-A Blocking Peptide, RTN4-B1 Blocking Peptide, RTN4-B2 Blocking Peptide, RTN4-C Blocking Peptide, RTN4, RTN-4, RTN 4, RTN-4 Blocking Peptide, RTN 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV |
|---|---|
| Molecular Weight | 22 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product