RuBisCO protein (31R-1085)

Purified native RuBisCO protein

Synonyms Ribulose-1 5-bisphosphate carboxylase oxygenase protein
Species Spinach
Protein Type Native
Applications SDS-PAGE, WB

Images

SDS-PAGE analysis of RuBisCO protein (31R-1085)

Specifications

Residues NNWPCNPEKTLISHVPKERLIMSFGSGYGGNSLLGKKCFALRIAGCIARDEGWLAEHMLIMSVTNPKGEE
Source Spinach leaf
Grade & Purity > 95% pure
Form & Buffer Liquid in PBS, with 10% glycerol.

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance Ribulose-1,5-bisphosphate carboxylase oxygenase, most commonly known by the shorter name RuBisCO, is an enzyme involved in the Calvin cycle that catalyzes the first major step of carbon fixation, a process by which the atoms of atmospheric carbon dioxide are made available to organisms in the form of energy-rich molecules such as glucose. RuBisCO catalyzes either the carboxylation or the oxygenation of ribulose-1,5-bisphosphate (also known as RuBP) with carbon dioxide or oxygen. RuBisCO is very important in terms of biological impact because it catalyzes the primary chemical reaction by which inorganic carbon permanently enters the biosphere.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • SDS-PAGE analysis of RuBisCO protein (31R-1085)

Availability: In stock

Price: €613.50
Size: 10 mg
OR
Shipping
View Our Distributors