RuBisCO protein (31R-1085)
Purified native RuBisCO protein
Overview
Overview
| Synonyms | Ribulose-1 5-bisphosphate carboxylase oxygenase protein |
|---|---|
| Species | Spinach |
| Protein Type | Native |
| Applications | SDS-PAGE, WB |
Specifications
| Residues | NNWPCNPEKTLISHVPKERLIMSFGSGYGGNSLLGKKCFALRIAGCIARDEGWLAEHMLIMSVTNPKGEE |
|---|---|
| Source | Spinach leaf |
| Grade & Purity | > 95% pure |
| Form & Buffer | Liquid in PBS, with 10% glycerol. |
Storage & Safety
| Storage | Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles |
|---|
General Information
| Biological Significance | Ribulose-1,5-bisphosphate carboxylase oxygenase, most commonly known by the shorter name RuBisCO, is an enzyme involved in the Calvin cycle that catalyzes the first major step of carbon fixation, a process by which the atoms of atmospheric carbon dioxide are made available to organisms in the form of energy-rich molecules such as glucose. RuBisCO catalyzes either the carboxylation or the oxygenation of ribulose-1,5-bisphosphate (also known as RuBP) with carbon dioxide or oxygen. RuBisCO is very important in terms of biological impact because it catalyzes the primary chemical reaction by which inorganic carbon permanently enters the biosphere. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product