RWDD2A antibody (70R-3777)

Rabbit polyclonal RWDD2A antibody raised against the N terminal of RWDD2A

Synonyms Polyclonal RWDD2A antibody, Anti-RWDD2A antibody, RWDD 2 antibody, RWDD2 antibody, RWDD2, MGC13523 antibody, RWDD-2 antibody, Rwd Domain Containing 2A antibody, dJ747H23.2 antibody, RWDD-2, RWDD 2, MGC138208 antibody
Specificity RWDD2A antibody was raised against the N terminal of RWDD2A
Cross Reactivity Human,Mouse
Applications WB
Immunogen RWDD2A antibody was raised using the N terminal of RWDD2A corresponding to a region with amino acids NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA
Assay Information RWDD2A Blocking Peptide, catalog no. 33R-6639, is also available for use as a blocking control in assays to test for specificity of this RWDD2A antibody


Western Blot analysis using RWDD2A antibody (70R-3777)

RWDD2A antibody (70R-3777) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RWDD2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of RWDD2A is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RWDD2A antibody (70R-3777) | RWDD2A antibody (70R-3777) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors