RWDD2A Blocking Peptide (33R-6639)
A synthetic peptide for use as a blocking control in assays to test for specificity of RWDD2A antibody, catalog no. 70R-3777
Overview
Overview
| Synonyms | RWDD2A control peptide, RWDD2A antibody Blocking Peptide, Anti-RWDD2A Blocking Peptide, Rwd Domain Containing 2A Blocking Peptide, MGC13523 Blocking Peptide, MGC138208 Blocking Peptide, RWDD2 Blocking Peptide, dJ747H23.2 Blocking Peptide, RWDD2, RWDD-2, RWDD 2, RWDD-2 Blocking Peptide, RWDD 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA |
|---|---|
| Molecular Weight | 32 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The specific function of RWDD2A is not yet known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product