RWDD2A Blocking Peptide (33R-6639)

A synthetic peptide for use as a blocking control in assays to test for specificity of RWDD2A antibody, catalog no. 70R-3777

Synonyms RWDD2A control peptide, RWDD2A antibody Blocking Peptide, Anti-RWDD2A Blocking Peptide, Rwd Domain Containing 2A Blocking Peptide, MGC13523 Blocking Peptide, MGC138208 Blocking Peptide, RWDD2 Blocking Peptide, dJ747H23.2 Blocking Peptide, RWDD2, RWDD-2, RWDD 2, RWDD-2 Blocking Peptide, RWDD 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA
Molecular Weight 32 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of RWDD2A is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors