S100A3 antibody (70R-1096)

Rabbit polyclonal S100A3 antibody raised against the N terminal of S100A3

Synonyms Polyclonal S100A3 antibody, Anti-S100A3 antibody, S-100 antibody, S100, S-100, S100E antibody, S100 Calcium Binding Protein A3 antibody, S 100 antibody, S 100
Specificity S100A3 antibody was raised against the N terminal of S100A3
Cross Reactivity Human
Applications IHC, WB
Immunogen S100A3 antibody was raised using the N terminal of S100A3 corresponding to a region with amino acids MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF
Assay Information S100A3 Blocking Peptide, catalog no. 33R-5733, is also available for use as a blocking control in assays to test for specificity of this S100A3 antibody


Immunohistochemical staining using S100A3 antibody (70R-1096)

S100A3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 11 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of S100A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance S100A3 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using S100A3 antibody (70R-1096) | S100A3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X
  • Western Blot analysis using S100A3 antibody (70R-1096) | S100A3 antibody (70R-1096) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors