SAA4 Blocking Peptide (33R-1030)
A synthetic peptide for use as a blocking control in assays to test for specificity of SAA4 antibody, catalog no. 70R-5924
Overview
Overview
| Synonyms | SAA4 control peptide, SAA4 antibody Blocking Peptide, Anti-SAA4 Blocking Peptide, Serum Amyloid A4 Constitutive Blocking Peptide, C-SAA Blocking Peptide, CSAA Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF |
|---|---|
| Molecular Weight | 2 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product