SAA4 Blocking Peptide (33R-1030)

A synthetic peptide for use as a blocking control in assays to test for specificity of SAA4 antibody, catalog no. 70R-5924

Synonyms SAA4 control peptide, SAA4 antibody Blocking Peptide, Anti-SAA4 Blocking Peptide, Serum Amyloid A4 Constitutive Blocking Peptide, C-SAA Blocking Peptide, CSAA Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF
Molecular Weight 2 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors