SAE1 antibody (70R-3174)

Rabbit polyclonal SAE1 antibody raised against the N terminal of SAE1

Synonyms Polyclonal SAE1 antibody, Anti-SAE1 antibody, HSPC140 antibody, SUA1 antibody, SAE 1 antibody, FLJ3091 antibody, SAE1, Sumo1 Activating Enzyme Subunit 1 antibody, SAE-1 antibody, SAE 1, SAE-1, AOS1 antibody
Specificity SAE1 antibody was raised against the N terminal of SAE1
Cross Reactivity Human
Applications WB
Immunogen SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE
Assay Information SAE1 Blocking Peptide, catalog no. 33R-6581, is also available for use as a blocking control in assays to test for specificity of this SAE1 antibody


Western Blot analysis using SAE1 antibody (70R-3174)

SAE1 antibody (70R-3174) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SAE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Posttranslational modification of proteins by the addition of the small protein SUMO, or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SAE1 antibody (70R-3174) | SAE1 antibody (70R-3174) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors