SAR1B antibody (70R-3167)

Rabbit polyclonal SAR1B antibody

Synonyms Polyclonal SAR1B antibody, Anti-SAR1B antibody, SARB 1 antibody, CMRD antibody, SAR1B, SARB-1, Sar1 Gene Homolog B antibody, GTBPB antibody, SARA2 antibody, SARB 1, SARB-1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SAR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ
Assay Information SAR1B Blocking Peptide, catalog no. 33R-8038, is also available for use as a blocking control in assays to test for specificity of this SAR1B antibody


Western Blot analysis using SAR1B antibody (70R-3167)

SAR1B antibody (70R-3167) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SAR1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SAR1B antibody (70R-3167) | SAR1B antibody (70R-3167) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors