SAR1B Blocking Peptide (33R-8038)
A synthetic peptide for use as a blocking control in assays to test for specificity of SAR1B antibody, catalog no. 70R-3167
Overview
Overview
| Synonyms | SAR1B control peptide, SAR1B antibody Blocking Peptide, Anti-SAR1B Blocking Peptide, Sar1 Gene Homolog B Blocking Peptide, CMRD Blocking Peptide, GTBPB Blocking Peptide, SARA2 Blocking Peptide, SAR1B, SARB-1, SARB 1, SARB-1 Blocking Peptide, SARB 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ |
|---|---|
| Molecular Weight | 22 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product