SARS antibody (70R-1445)

Rabbit polyclonal SARS antibody raised against the middle region of SARS

Synonyms Polyclonal SARS antibody, Anti-SARS antibody, Seryl-tRNA Synthetase antibody
Specificity SARS antibody was raised against the middle region of SARS
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen SARS antibody was raised using the middle region of SARS corresponding to a region with amino acids SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL
Assay Information SARS Blocking Peptide, catalog no. 33R-8713, is also available for use as a blocking control in assays to test for specificity of this SARS antibody

Images

Western Blot analysis using SARS antibody (70R-1445)

SARS antibody (70R-1445) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SARS antibody (70R-1445) | SARS antibody (70R-1445) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors