SBDS antibody (70R-1181)

Rabbit polyclonal SBDS antibody raised against the C terminal of SBDS

Synonyms Polyclonal SBDS antibody, Anti-SBDS antibody, SWDS antibody, Shwachman-Bodian-Diamond Syndrome antibody, SDS antibody, CGI-97 antibody, FLJ10917 antibody
Specificity SBDS antibody was raised against the C terminal of SBDS
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen SBDS antibody was raised using the C terminal of SBDS corresponding to a region with amino acids DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Assay Information SBDS Blocking Peptide, catalog no. 33R-2237, is also available for use as a blocking control in assays to test for specificity of this SBDS antibody


Immunohistochemical staining using SBDS antibody (70R-1181)

SBDS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SBDS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SBDS is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SBDS antibody (70R-1181) | SBDS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SBDS antibody (70R-1181) | SBDS antibody (70R-1181) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors