SC4MOL Blocking Peptide (33R-5780)

A synthetic peptide for use as a blocking control in assays to test for specificity of SC4MOL antibody, catalog no. 70R-1734

Synonyms SC4MOL control peptide, SC4MOL antibody Blocking Peptide, Anti-SC4MOL Blocking Peptide, Sterol-C4-Methyl Oxidase-Like Blocking Peptide, DESP4 Blocking Peptide, ERG25 Blocking Peptide, MGC104344 Blocking Peptide, SC4MOL, SCMOL-4, SCMOL 4, SCMOL-4 Blocking Peptide, SCMOL 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
Molecular Weight 35 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors