SC4MOL Blocking Peptide (33R-5780)
A synthetic peptide for use as a blocking control in assays to test for specificity of SC4MOL antibody, catalog no. 70R-1734
Overview
Overview
| Synonyms | SC4MOL control peptide, SC4MOL antibody Blocking Peptide, Anti-SC4MOL Blocking Peptide, Sterol-C4-Methyl Oxidase-Like Blocking Peptide, DESP4 Blocking Peptide, ERG25 Blocking Peptide, MGC104344 Blocking Peptide, SC4MOL, SCMOL-4, SCMOL 4, SCMOL-4 Blocking Peptide, SCMOL 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product