SCD antibody (70R-1136)

Rabbit polyclonal SCD antibody

Synonyms Polyclonal SCD antibody, Anti-SCD antibody, Delta-9-Desaturase antibody, Stearoyl-Coa Desaturase antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SCD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG
Assay Information SCD Blocking Peptide, catalog no. 33R-3805, is also available for use as a blocking control in assays to test for specificity of this SCD antibody

Images

Western Blot analysis using SCD antibody (70R-1136)

SCD antibody (70R-1136) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SCD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SCD antibody (70R-1136) | SCD antibody (70R-1136) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors