SCFD1 antibody (70R-3833)

Rabbit polyclonal SCFD1 antibody raised against the N terminal of SCFD1

Synonyms Polyclonal SCFD1 antibody, Anti-SCFD1 antibody, SCFD-1 antibody, Sec1 Family Domain Containing 1 antibody, SCFD1, STXBP1L2 antibody, C14orf163 antibody, RA410 antibody, SLY1 antibody, SCFD 1, SCFD 1 antibody, SCFD-1, KIAA0917 antibody
Specificity SCFD1 antibody was raised against the N terminal of SCFD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SCFD1 antibody was raised using the N terminal of SCFD1 corresponding to a region with amino acids SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME
Assay Information SCFD1 Blocking Peptide, catalog no. 33R-8323, is also available for use as a blocking control in assays to test for specificity of this SCFD1 antibody

Images

Western Blot analysis using SCFD1 antibody (70R-3833)

SCFD1 antibody (70R-3833) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCFD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SCFD1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SCFD1 antibody (70R-3833) | SCFD1 antibody (70R-3833) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors