SCN3B antibody (70R-5225)

Rabbit polyclonal SCN3B antibody raised against the N terminal of SCN3B

Synonyms Polyclonal SCN3B antibody, Anti-SCN3B antibody, SCNB-3, SCNB 3, SCNB-3 antibody, SCN3B, SCNB 3 antibody, Sodium Channel Voltage-Gated Type Iii Beta antibody
Specificity SCN3B antibody was raised against the N terminal of SCN3B
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen SCN3B antibody was raised using the N terminal of SCN3B corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
Assay Information SCN3B Blocking Peptide, catalog no. 33R-8090, is also available for use as a blocking control in assays to test for specificity of this SCN3B antibody


Western Blot analysis using SCN3B antibody (70R-5225)

Western Blot showing SCN3B antibody used at a concentration of 1-2 ug/ml to detect its target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCN3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SCN3B antibody (70R-5225) | Western Blot showing SCN3B antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors