SCP2 Blocking Peptide (33R-6715)

A synthetic peptide for use as a blocking control in assays to test for specificity of SCP2 antibody, catalog no. 70R-3015

Synonyms SCP2 control peptide, SCP2 antibody Blocking Peptide, Anti-SCP2 Blocking Peptide, Sterol Carrier Protein 2 Blocking Peptide, DKFZp686C12188 Blocking Peptide, DKFZp686D11188 Blocking Peptide, NLTP Blocking Peptide, NSL-TP Blocking Peptide, SCPX Blocking Peptide, SCP2, SCP-2, SCP 2, SCP-2 Blocking Peptide, SCP 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA
Molecular Weight 35 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors