SCP2 Blocking Peptide (33R-6715)
A synthetic peptide for use as a blocking control in assays to test for specificity of SCP2 antibody, catalog no. 70R-3015
Overview
Overview
| Synonyms | SCP2 control peptide, SCP2 antibody Blocking Peptide, Anti-SCP2 Blocking Peptide, Sterol Carrier Protein 2 Blocking Peptide, DKFZp686C12188 Blocking Peptide, DKFZp686D11188 Blocking Peptide, NLTP Blocking Peptide, NSL-TP Blocking Peptide, SCPX Blocking Peptide, SCP2, SCP-2, SCP 2, SCP-2 Blocking Peptide, SCP 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product