SCYL1 Blocking Peptide (33R-10323)

A synthetic peptide for use as a blocking control in assays to test for specificity of SCYL1 antibody, catalog no. 70R-10406

Synonyms SCYL1 control peptide, SCYL1 antibody Blocking Peptide, Anti-SCYL1 Blocking Peptide, SCY1-like 1, S. cerevisiae Blocking Peptide, GKLP Blocking Peptide, HT019 Blocking Peptide, MGC78454 Blocking Peptide, NKTL Blocking Peptide, NTKL Blocking Peptide, P105 Blocking Peptide, TAPK Blocking Peptide, TEIF Blocking Peptide, TRAP Blocking Peptide, SCYL1, SCYL-1, SCYL 1, SCYL-1 Blocking Peptide, SCYL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues FATLSARPSTQPRPDSWGEDNWEGLETDSRQVKAELARKKREERRREMEA
Molecular Weight 86 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SCYL1 regulates COPI-mediated retrograde traffic. It has no detectable kinase activity in vitro.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors