SDCBP antibody (70R-1718)

Rabbit polyclonal SDCBP antibody

Synonyms Polyclonal SDCBP antibody, Anti-SDCBP antibody, Syndecan Binding Protein antibody, TACIP18 antibody, Syntenin antibody, MDA-9 antibody, SYCL antibody, ST1 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV
Assay Information SDCBP Blocking Peptide, catalog no. 33R-9561, is also available for use as a blocking control in assays to test for specificity of this SDCBP antibody


Immunohistochemical staining using SDCBP antibody (70R-1718)

SDCBP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SDCBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SDCBP was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SDCBP antibody (70R-1718) | SDCBP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SDCBP antibody (70R-1718) | SDCBP antibody (70R-1718) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors