SDCCAG8 antibody (70R-4002)

Rabbit polyclonal SDCCAG8 antibody raised against the N terminal of SDCCAG8

Synonyms Polyclonal SDCCAG8 antibody, Anti-SDCCAG8 antibody, SDCCAG8, Serologically Defined Colon Cancer Antigen 8 antibody, NY-CO-8 antibody, SDCCAG 8 antibody, CCCAP antibody, SDCCAG-8, SDCCAG-8 antibody, SDCCAG 8, HSPC085 antibody
Specificity SDCCAG8 antibody was raised against the N terminal of SDCCAG8
Cross Reactivity Human
Applications WB
Immunogen SDCCAG8 antibody was raised using the N terminal of SDCCAG8 corresponding to a region with amino acids HEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLE
Assay Information SDCCAG8 Blocking Peptide, catalog no. 33R-3716, is also available for use as a blocking control in assays to test for specificity of this SDCCAG8 antibody


Western Blot analysis using SDCCAG8 antibody (70R-4002)

SDCCAG8 antibody (70R-4002) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SDCCAG8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SDCCAG8 encodes a centrosome associated protein. This protein may be involved in organizing the centrosome during interphase and mitosis. Mutations in this gene are associated with retinal-renal ciliopathy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SDCCAG8 antibody (70R-4002) | SDCCAG8 antibody (70R-4002) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors