SDF2 antibody (70R-1569)

Rabbit polyclonal SDF2 antibody raised against the N terminal of SDF2

Synonyms Polyclonal SDF2 antibody, Anti-SDF2 antibody, Stromal Cell-Derived Factor 2 antibody, SDF-2 antibody, SDF 2, SDF 2 antibody, SDF-2, SDF2
Specificity SDF2 antibody was raised against the N terminal of SDF2
Cross Reactivity Human, Mouse, Rat
Applications IHC, WB
Immunogen SDF2 antibody was raised using the N terminal of SDF2 corresponding to a region with amino acids KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC
Assay Information SDF2 Blocking Peptide, catalog no. 33R-4518, is also available for use as a blocking control in assays to test for specificity of this SDF2 antibody


Immunohistochemical staining using SDF2 antibody (70R-1569)

SDF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SDF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SDF2 antibody (70R-1569) | SDF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SDF2 antibody (70R-1569) | SDF2 antibody (70R-1569) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using SDF2 antibody (70R-1569) | SDF2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors