SDF4 antibody (70R-1850)

Rabbit polyclonal SDF4 antibody raised against the C terminal of SDF4

Synonyms Polyclonal SDF4 antibody, Anti-SDF4 antibody, SDF-4, SDF 4 antibody, SDF 4, Cab45 antibody, SDF4, RP5-902P8.6 antibody, Stromal Cell Derived Factor 4 antibody, SDF-4 antibody
Specificity SDF4 antibody was raised against the C terminal of SDF4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SDF4 antibody was raised using the C terminal of SDF4 corresponding to a region with amino acids KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA
Assay Information SDF4 Blocking Peptide, catalog no. 33R-4609, is also available for use as a blocking control in assays to test for specificity of this SDF4 antibody

Images

Western Blot analysis using SDF4 antibody (70R-1850)

SDF4 antibody (70R-1850) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SDF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SDF4 antibody (70R-1850) | SDF4 antibody (70R-1850) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors