SDS Blocking Peptide (33R-1011)
A synthetic peptide for use as a blocking control in assays to test for specificity of SDS antibody, catalog no. 70R-3627
Overview
Overview
| Synonyms | SDS control peptide, SDS antibody Blocking Peptide, Anti-SDS Blocking Peptide, Serine Dehydratase Blocking Peptide, SDH Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA |
|---|---|
| Molecular Weight | 34 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product