SEC14L4 Blocking Peptide (33R-6510)
A synthetic peptide for use as a blocking control in assays to test for specificity of SEC14L4 antibody, catalog no. 70R-3716
Overview
Overview
| Synonyms | SEC14L4 control peptide, SEC14L4 antibody Blocking Peptide, Anti-SEC14L4 Blocking Peptide, Sec14-Like 4 Blocking Peptide, TAP3 Blocking Peptide, SEC14, SEC-14, SEC 14, SEC-14 Blocking Peptide, SEC 14 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ |
|---|---|
| Molecular Weight | 47 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SEC14L4 is a probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product