SEC14L4 Blocking Peptide (33R-6510)

A synthetic peptide for use as a blocking control in assays to test for specificity of SEC14L4 antibody, catalog no. 70R-3716

Synonyms SEC14L4 control peptide, SEC14L4 antibody Blocking Peptide, Anti-SEC14L4 Blocking Peptide, Sec14-Like 4 Blocking Peptide, TAP3 Blocking Peptide, SEC14, SEC-14, SEC 14, SEC-14 Blocking Peptide, SEC 14 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ
Molecular Weight 47 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEC14L4 is a probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors