SELENBP1 antibody (70R-2556)

Rabbit polyclonal SELENBP1 antibody raised against the N terminal of SELENBP1

Synonyms Polyclonal SELENBP1 antibody, Anti-SELENBP1 antibody, hSBP antibody, LPSB antibody, Selenium Binding Protein 1 antibody, SELENBP1, SELENBP-1, hSP56 antibody, SP56 antibody, SELENBP 1, SELENBP-1 antibody, FLJ13813 antibody, SELENBP 1 antibody
Specificity SELENBP1 antibody was raised against the N terminal of SELENBP1
Cross Reactivity Human,Mouse
Applications WB
Immunogen SELENBP1 antibody was raised using the N terminal of SELENBP1 corresponding to a region with amino acids MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD
Assay Information SELENBP1 Blocking Peptide, catalog no. 33R-5778, is also available for use as a blocking control in assays to test for specificity of this SELENBP1 antibody


Western Blot analysis using SELENBP1 antibody (70R-2556)

SELENBP1 antibody (70R-2556) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SELENBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SELENBP1 antibody (70R-2556) | SELENBP1 antibody (70R-2556) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors