SEMA6D Blocking Peptide (33R-9805)
A synthetic peptide for use as a blocking control in assays to test for specificity of SEMA6D antibody, catalog no. 70R-7125
Overview
Overview
| Synonyms | SEMA6D control peptide, SEMA6D antibody Blocking Peptide, Anti-SEMA6D Blocking Peptide, Sema Domain Immunoglobulin Domain 6D Blocking Peptide, FLJ11598 Blocking Peptide, KIAA1479 Blocking Peptide, SEMA6D, SEMAD-6, SEMAD 6, SEMAD-6 Blocking Peptide, SEMAD 6 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY |
|---|---|
| Molecular Weight | 52 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product