SENP1 antibody (70R-3122)

Rabbit polyclonal SENP1 antibody raised against the middle region of SENP1

Synonyms Polyclonal SENP1 antibody, Anti-SENP1 antibody, SENP-1 antibody, SENP-1, SENP 1, SENP 1 antibody, SENP1, Sumo1/Sentrin Specific Peptidase 1 antibody, SuPr-2 antibody
Specificity SENP1 antibody was raised against the middle region of SENP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SENP1 antibody was raised using the middle region of SENP1 corresponding to a region with amino acids PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL
Assay Information SENP1 Blocking Peptide, catalog no. 33R-7308, is also available for use as a blocking control in assays to test for specificity of this SENP1 antibody


Western blot analysis using SENP1 antibody (70R-3122)

Recommended SENP1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SENP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The covalent modification of proteins by the small ubiquitin-like protein SUMO is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using SENP1 antibody (70R-3122) | Recommended SENP1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors